SCOPe 2.05: Domain d3nbzf_: 3nbz F:

Lineage for d3nbzf_ (3nbz F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d3nbzf_: 3nbz F: [213874]
   automated match to d3ea5a_
   complexed with gtp, mg, na

Details for d3nbzf_

PDB Entry: 3nbz, 2.8 Å

PDB Description: crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal i)

PDB Compounds: (F:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3nbzf_:

Sequence; same for both SEQRES and ATOM records:

>d3nbzf_ c.37.1.8 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp

Timeline for d3nbzf_:

• d3nbzf_ first appeared in SCOPe 2.03
  
• d3nbzf_ appears in SCOPe 2.04
  
• d3nbzf_ appears in SCOPe 2.06
  
• d3nbzf_ appears in the current release, SCOPe 2.08