Lineage for d3nbzf_ (3nbz F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868634Domain d3nbzf_: 3nbz F: [213874]
    automated match to d3ea5a_
    complexed with gtp, mg, na

Details for d3nbzf_

PDB Entry: 3nbz (more details), 2.8 Å

PDB Description: crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal i)
PDB Compounds: (F:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3nbzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbzf_ c.37.1.8 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp

SCOPe Domain Coordinates for d3nbzf_:

Click to download the PDB-style file with coordinates for d3nbzf_.
(The format of our PDB-style files is described here.)

Timeline for d3nbzf_: