| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
| Domain d1c5db2: 1c5d B:118-215 [21387] Other proteins in same PDB: d1c5da1, d1c5da2, d1c5db1, d1c5dh1, d1c5dl1, d1c5dl2 part of antibody against the main immunogenic region of the human muscle acetylcholine receptor |
PDB Entry: 1c5d (more details), 2.4 Å
SCOPe Domain Sequences for d1c5db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5db2 b.1.1.2 (B:118-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkklerr
Timeline for d1c5db2: