Lineage for d1c5db2 (1c5d B:118-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2748487Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 2748496Domain d1c5db2: 1c5d B:118-215 [21387]
    Other proteins in same PDB: d1c5da1, d1c5da2, d1c5db1, d1c5dh1, d1c5dl1, d1c5dl2
    part of antibody against the main immunogenic region of the human muscle acetylcholine receptor

Details for d1c5db2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
PDB Compounds: (B:) monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOPe Domain Sequences for d1c5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5db2 b.1.1.2 (B:118-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkklerr

SCOPe Domain Coordinates for d1c5db2:

Click to download the PDB-style file with coordinates for d1c5db2.
(The format of our PDB-style files is described here.)

Timeline for d1c5db2: