Lineage for d3nbfc_ (3nbf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873046Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries)
  8. 2873064Domain d3nbfc_: 3nbf C: [213867]
    automated match to d1q0ua_
    complexed with 8od, 8op; mutant

Details for d3nbfc_

PDB Entry: 3nbf (more details), 1.9 Å

PDB Description: q28e mutant of hera helicase n-terminal domain bound to 8-oxo-adp
PDB Compounds: (C:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d3nbfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbfc_ c.37.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

SCOPe Domain Coordinates for d3nbfc_:

Click to download the PDB-style file with coordinates for d3nbfc_.
(The format of our PDB-style files is described here.)

Timeline for d3nbfc_: