| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries) |
| Domain d3nbfb_: 3nbf B: [213866] automated match to d1q0ua_ complexed with 8od, 8op; mutant |
PDB Entry: 3nbf (more details), 1.9 Å
SCOPe Domain Sequences for d3nbfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nbfb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
efkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpiae
rlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrga
davvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtllf
satlpswakrlaerymknpvlinvik
Timeline for d3nbfb_: