SCOPe 2.04: Domain d3nbfa_: 3nbf A:

Lineage for d3nbfa_ (3nbf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [187453] (12 PDB entries)

8. Domain d3nbfa_: 3nbf A: [213865]
   automated match to d1q0ua_
   complexed with 8od, 8op; mutant

Details for d3nbfa_

PDB Entry: 3nbf, 1.9 Å

PDB Description: q28e mutant of hera helicase n-terminal domain bound to 8-oxo-adp

PDB Compounds: (A:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d3nbfa_:

Sequence; same for both SEQRES and ATOM records:

>d3nbfa_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

Timeline for d3nbfa_:

• d3nbfa_ first appeared in SCOPe 2.03
  
• d3nbfa_ appears in SCOPe 2.05
  
• d3nbfa_ appears in the current release, SCOPe 2.08