Lineage for d3nbab_ (3nba B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469285Species Mycobacterium tuberculosis [TaxId:1773] [226769] (5 PDB entries)
  8. 2469296Domain d3nbab_: 3nba B: [213862]
    automated match to d3f3ma_
    complexed with apc, mg

Details for d3nbab_

PDB Entry: 3nba (more details), 2.68 Å

PDB Description: Phosphopantetheine Adenylyltranferase from Mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (AMPCPP)
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nbab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbab_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrl

SCOPe Domain Coordinates for d3nbab_:

Click to download the PDB-style file with coordinates for d3nbab_.
(The format of our PDB-style files is described here.)

Timeline for d3nbab_: