Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries) |
Domain d1c5da2: 1c5d A:107-213 [21386] Other proteins in same PDB: d1c5da1, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl1 part of antibody against the main immunogenic region of the human muscle acetylcholine receptor |
PDB Entry: 1c5d (more details), 2.4 Å
SCOPe Domain Sequences for d1c5da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5da2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d1c5da2: