Lineage for d3nala1 (3nal A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028074Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 3028075Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 3028076Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 3028077Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 3028078Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries)
    Uniprot P04191
  8. 3028108Domain d3nala1: 3nal A:1-124,A:240-343,A:751-994 [213854]
    Other proteins in same PDB: d3nala2, d3nala3, d3nala4
    automated match to d1wpga4
    complexed with dbk, k, mg

Details for d3nala1

PDB Entry: 3nal (more details), 2.65 Å

PDB Description: SR Ca(2+)-ATPase in the HnE2 state complexed with the Thapsigargin derivative DTB
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d3nala1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nala1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d3nala1:

Click to download the PDB-style file with coordinates for d3nala1.
(The format of our PDB-style files is described here.)

Timeline for d3nala1: