Lineage for d3nagb2 (3nag B:156-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892118Species Thermoplasma volcanium [TaxId:273116] [226149] (1 PDB entry)
  8. 2892122Domain d3nagb2: 3nag B:156-286 [213853]
    automated match to d1dkra2
    complexed with adp, mg, so4

Details for d3nagb2

PDB Entry: 3nag (more details), 1.75 Å

PDB Description: Crystal structure of the phosphoribosylpyrophosphate (PRPP) synthetase from Thermoplasma Volcanium in complex with ADP
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3nagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nagb2 c.61.1.0 (B:156-286) automated matches {Thermoplasma volcanium [TaxId: 273116]}
yvvspddgglarvadisaklgkkhffiekkriddrtvemkvpnvdvngkkllivddiist
ggtiakssgllrekgaskiyvsavhglfvngsenkilqnadeihvtdtveskfsdisvyq
evcnyirdida

SCOPe Domain Coordinates for d3nagb2:

Click to download the PDB-style file with coordinates for d3nagb2.
(The format of our PDB-style files is described here.)

Timeline for d3nagb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nagb1