SCOPe 2.05: Domain d3naga1: 3nag A:1-155

Lineage for d3naga1 (3nag A:1-155)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:273116] [226149] (1 PDB entry)

8. Domain d3naga1: 3nag A:1-155 [213850]
   automated match to d1dkua1
   complexed with adp, mg, so4

Details for d3naga1

PDB Entry: 3nag, 1.75 Å

PDB Description: Crystal structure of the phosphoribosylpyrophosphate (PRPP) synthetase from Thermoplasma Volcanium in complex with ADP

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3naga1:

Sequence; same for both SEQRES and ATOM records:

>d3naga1 c.61.1.0 (A:1-155) automated matches {Thermoplasma volcanium [TaxId: 273116]}
mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda
evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat
vdihdektlsyskvkfsdlhandaivryyknvdvd

Timeline for d3naga1:

• d3naga1 first appeared in SCOPe 2.03
  
• d3naga1 appears in SCOPe 2.04
  
• d3naga1 appears in SCOPe 2.06
  
• d3naga1 appears in the current release, SCOPe 2.08