SCOP 1.55: Domain d1c5dh2: 1c5d H:118-214

Lineage for d1c5dh2 (1c5d H:118-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [49094] (1 PDB entry)

8. Domain d1c5dh2: 1c5d H:118-214 [21385]
   Other proteins in same PDB: d1c5da1, d1c5db1, d1c5dh1, d1c5dl1

Details for d1c5dh2

PDB Entry: 1c5d, 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dh2:

Sequence; same for both SEQRES and ATOM records:

>d1c5dh2 b.1.1.2 (H:118-214) Immunoglobulin (constant domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkler

Timeline for d1c5dh2:

• d1c5dh2 appears in SCOP 1.57
  
• d1c5dh2 appears in the current release, SCOPe 2.08