![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
![]() | Domain d1c5dh2: 1c5d H:118-214 [21385] Other proteins in same PDB: d1c5da1, d1c5da2, d1c5db1, d1c5dh1, d1c5dl1, d1c5dl2 part of antibody against the main immunogenic region of the human muscle acetylcholine receptor |
PDB Entry: 1c5d (more details), 2.4 Å
SCOPe Domain Sequences for d1c5dh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5dh2 b.1.1.2 (H:118-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg lytltssvtsstwpsqtvtcnvahpasstkvdkkler
Timeline for d1c5dh2: