Lineage for d1c5dl2 (1c5d L:107-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289993Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)
  8. 289997Domain d1c5dl2: 1c5d L:107-213 [21384]
    Other proteins in same PDB: d1c5da1, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl1

Details for d1c5dl2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dl2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOP Domain Coordinates for d1c5dl2:

Click to download the PDB-style file with coordinates for d1c5dl2.
(The format of our PDB-style files is described here.)

Timeline for d1c5dl2: