Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [49094] (1 PDB entry) |
Domain d1c5dl2: 1c5d L:107-213 [21384] Other proteins in same PDB: d1c5da1, d1c5db1, d1c5dh1, d1c5dl1 |
PDB Entry: 1c5d (more details), 2.4 Å
SCOP Domain Sequences for d1c5dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5dl2 b.1.1.2 (L:107-213) Immunoglobulin (constant domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d1c5dl2: