Lineage for d1c5dl2 (1c5d L:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749525Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries)
  8. 2749540Domain d1c5dl2: 1c5d L:107-213 [21384]
    Other proteins in same PDB: d1c5da1, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl1
    part of antibody against the main immunogenic region of the human muscle acetylcholine receptor

Details for d1c5dl2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
PDB Compounds: (L:) monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOPe Domain Sequences for d1c5dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dl2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOPe Domain Coordinates for d1c5dl2:

Click to download the PDB-style file with coordinates for d1c5dl2.
(The format of our PDB-style files is described here.)

Timeline for d1c5dl2: