Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries) Uniprot P05979 32-584 |
Domain d3n8za1: 3n8z A:32-73 [213823] Other proteins in same PDB: d3n8za2, d3n8zb2 automated match to d1q4ga2 complexed with bog, flp, hem |
PDB Entry: 3n8z (more details), 2.9 Å
SCOPe Domain Sequences for d3n8za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n8za1 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d3n8za1: