SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3n8xb2 (3n8x B:74-584)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002906Species Sheep (Ovis aries) [TaxId:9940] [48137] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2002915Domain d3n8xb2: 3n8x B:74-584 [213822]
    Other proteins in same PDB: d3n8xa1, d3n8xb1
    automated match to d1q4ga1
    complexed with bog, hem, nag, nim

Details for d3n8xb2

PDB Entry: 3n8x (more details), 2.75 Å

PDB Description: Crystal Structure of Cyclooxygenase-1 in Complex with Nimesulide
PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d3n8xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8xb2 a.93.1.2 (B:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d3n8xb2:

Click to download the PDB-style file with coordinates for d3n8xb2.
(The format of our PDB-style files is described here.)

Timeline for d3n8xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n8xb1