SCOPe 2.04: Domain d3n8xb1: 3n8x B:32-73

Lineage for d3n8xb1 (3n8x B:32-73)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
   Uniprot P05979 32-584

8. Domain d3n8xb1: 3n8x B:32-73 [213821]
   Other proteins in same PDB: d3n8xa2, d3n8xb2
   automated match to d1q4ga2
   complexed with bog, hem, nag, nim

Details for d3n8xb1

PDB Entry: 3n8x, 2.75 Å

PDB Description: crystal structure of cyclooxygenase-1 in complex with nimesulide

PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d3n8xb1:

Sequence; same for both SEQRES and ATOM records:

>d3n8xb1 g.3.11.1 (B:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d3n8xb1:

• d3n8xb1 first appeared in SCOPe 2.03
  
• d3n8xb1 appears in SCOPe 2.05
  
• d3n8xb1 appears in the current release, SCOPe 2.08