Lineage for d3n8xb1 (3n8x B:32-73)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2230373Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2230374Family g.3.11.1: EGF-type module [57197] (23 protein domains)
  6. 2230724Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2230767Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2230776Domain d3n8xb1: 3n8x B:32-73 [213821]
    Other proteins in same PDB: d3n8xa2, d3n8xb2
    automated match to d1q4ga2
    complexed with bog, hem, nag, nim

Details for d3n8xb1

PDB Entry: 3n8x (more details), 2.75 Å

PDB Description: Crystal Structure of Cyclooxygenase-1 in Complex with Nimesulide
PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d3n8xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8xb1 g.3.11.1 (B:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d3n8xb1:

Click to download the PDB-style file with coordinates for d3n8xb1.
(The format of our PDB-style files is described here.)

Timeline for d3n8xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n8xb2