| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1ct8c2: 1ct8 C:108-214 [21382] Other proteins in same PDB: d1ct8a1, d1ct8b1, d1ct8b2, d1ct8c1, d1ct8d1, d1ct8d2 part of catalytic Fab 7C8 |
PDB Entry: 1ct8 (more details), 2.2 Å
SCOP Domain Sequences for d1ct8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct8c2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1ct8c2: