SCOP 1.61: Domain d1ct8c2: 1ct8 C:108-214

Lineage for d1ct8c2 (1ct8 C:108-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Catalytic Fab 7C8, (mouse), kappa L chain [49093] (1 PDB entry)

8. Domain d1ct8c2: 1ct8 C:108-214 [21382]
   Other proteins in same PDB: d1ct8a1, d1ct8b1, d1ct8c1, d1ct8d1

Details for d1ct8c2

PDB Entry: 1ct8, 2.2 Å

PDB Description: catalytic antibody 7c8 complex

SCOP Domain Sequences for d1ct8c2:

Sequence; same for both SEQRES and ATOM records:

>d1ct8c2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ct8c2:

• d1ct8c2 first appeared (with stable ids) in SCOP 1.55
  
• d1ct8c2 appears in SCOP 1.59
  
• d1ct8c2 appears in SCOP 1.63
  
• d1ct8c2 appears in the current release, SCOPe 2.08