| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Catalytic Fab 7C8, (mouse), kappa L chain [49093] (1 PDB entry) |
| Domain d1ct8c2: 1ct8 C:108-214 [21382] Other proteins in same PDB: d1ct8a1, d1ct8b1, d1ct8c1, d1ct8d1 |
PDB Entry: 1ct8 (more details), 2.2 Å
SCOP Domain Sequences for d1ct8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct8c2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1ct8c2: