Lineage for d3n8ga2 (3n8g A:125-239)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331921Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 1331922Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 1331923Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 1331924Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (37 PDB entries)
    Uniprot P04191
  8. 1331940Domain d3n8ga2: 3n8g A:125-239 [213790]
    Other proteins in same PDB: d3n8ga1, d3n8ga3, d3n8ga4
    automated match to d1wpga1
    complexed with acp, ca, k

Details for d3n8ga2

PDB Entry: 3n8g (more details), 2.58 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-CaAMPPCP form
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform SERCA 1a

SCOPe Domain Sequences for d3n8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8ga2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d3n8ga2:

Click to download the PDB-style file with coordinates for d3n8ga2.
(The format of our PDB-style files is described here.)

Timeline for d3n8ga2: