Lineage for d1r24d2 (1r24 D:123-217)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453777Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
  8. 453784Domain d1r24d2: 1r24 D:123-217 [21379]
    Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b1, d1r24c1, d1r24c2, d1r24d1
    part of Fab R24 from murine ascites

Details for d1r24d2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24d2 b.1.1.2 (D:123-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

SCOP Domain Coordinates for d1r24d2:

Click to download the PDB-style file with coordinates for d1r24d2.
(The format of our PDB-style files is described here.)

Timeline for d1r24d2: