SCOPe 2.06: Domain d3n8ga1: 3n8g A:1-124,A:240-343,A:751-994

Lineage for d3n8ga1 (3n8g A:1-124,A:240-343,A:751-994)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family)

5. Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
   Uniprot P04191

8. Domain d3n8ga1: 3n8g A:1-124,A:240-343,A:751-994 [213789]
   Other proteins in same PDB: d3n8ga2, d3n8ga3, d3n8ga4
   automated match to d1wpga4
   complexed with acp, ca, k

Details for d3n8ga1

PDB Entry: 3n8g, 2.58 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-CaAMPPCP form

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform SERCA 1a

SCOPe Domain Sequences for d3n8ga1:

Sequence; same for both SEQRES and ATOM records:

>d3n8ga1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d3n8ga1:

• d3n8ga1 first appeared in SCOPe 2.03
  
• d3n8ga1 appears in SCOPe 2.05
  
• d3n8ga1 appears in SCOPe 2.07
  
• d3n8ga1 appears in the current release, SCOPe 2.08