Lineage for d3n8db2 (3n8d B:129-356)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979199Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries)
  8. 2979205Domain d3n8db2: 3n8d B:129-356 [213788]
    Other proteins in same PDB: d3n8da1, d3n8db1, d3n8db3
    automated match to d1ehib2
    complexed with anp, cl, so4

Details for d3n8db2

PDB Entry: 3n8d (more details), 2.3 Å

PDB Description: Crystal structure of Staphylococcus aureus VRSA-9 D-Ala:D-Ala ligase
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3n8db2:

Sequence, based on SEQRES records: (download)

>d3n8db2 d.142.1.0 (B:129-356) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy
kskykdgkvqlkipadldedvqltlrnmaleafketdcsglvradffvtednqiyinetn
ampgftafsmypklwenmglsypelitklielakerhqdkqknkykid

Sequence, based on observed residues (ATOM records): (download)

>d3n8db2 d.142.1.0 (B:129-356) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlvgiskcn
neaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafqlkipa
dldedvqltlrnmaleafketdcsglvradffvtednqiyinetnampgftafsmypklw
enmglsypelitklielakerhqdkqknkykid

SCOPe Domain Coordinates for d3n8db2:

Click to download the PDB-style file with coordinates for d3n8db2.
(The format of our PDB-style files is described here.)

Timeline for d3n8db2: