SCOPe 2.07: Domain d3n8da2: 3n8d A:129-353

Lineage for d3n8da2 (3n8d A:129-353)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (38 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries)

8. Domain d3n8da2: 3n8d A:129-353 [213786]
   Other proteins in same PDB: d3n8da1, d3n8db1, d3n8db3
   automated match to d1ehib2
   complexed with anp, cl, so4

Details for d3n8da2

PDB Entry: 3n8d, 2.3 Å

PDB Description: Crystal structure of Staphylococcus aureus VRSA-9 D-Ala:D-Ala ligase

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3n8da2:

Sequence, based on SEQRES records:

>d3n8da2 d.142.1.0 (A:129-353) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy
kskykdgkvqlkipadldedvqltlrnmaleafketdcsglvradffvtednqiyinetn
ampgftafsmypklwenmglsypelitklielakerhqdkqknky

Sequence, based on observed residues (ATOM records):

>d3n8da2 d.142.1.0 (A:129-353) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvvqlkipad
ldedvqltlrnmaleafketdcsglvradffvtednqiyinetnampgftafsmypklwe
nmglsypelitklielakerhqdkqknky

Timeline for d3n8da2:

• d3n8da2 first appeared in SCOPe 2.03
  
• d3n8da2 appears in SCOPe 2.06
  
• d3n8da2 appears in the current release, SCOPe 2.08