SCOPe 2.08: Domain d3n7hb_: 3n7h B:

Lineage for d3n7hb_ (3n7h B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (10 species)
   not a true protein

7. Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries)

8. Domain d3n7hb_: 3n7h B: [213781]
   automated match to d4fqtb_
   complexed with cl, de3, mg, moh, peu

Details for d3n7hb_

PDB Entry: 3n7h, 1.6 Å

PDB Description: crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg

PDB Compounds: (B:) odorant binding protein

SCOPe Domain Sequences for d3n7hb_:

Sequence; same for both SEQRES and ATOM records:

>d3n7hb_ a.39.2.0 (B:) automated matches {Anopheles gambiae [TaxId: 180454]}
dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
hyflv

Timeline for d3n7hb_:

• d3n7hb_ first appeared in SCOPe 2.03
  
• d3n7hb_ appears in SCOPe 2.07