SCOPe 2.05: Domain d1r24b2: 1r24 B:123-217

Lineage for d1r24b2 (1r24 B:123-217)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
Domain d1r24b2: 1r24 B:123-217 [21377]
Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b1, d1r24c1, d1r24c2, d1r24d1
part of Fab R24 from murine ascites

Details for d1r24b2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

PDB Compounds: (B:) protein (igg3-kappa antibody (heavy chain))

SCOPe Domain Sequences for d1r24b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24b2 b.1.1.2 (B:123-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

SCOPe Domain Coordinates for d1r24b2:

Click to download the PDB-style file with coordinates for d1r24b2.
(The format of our PDB-style files is described here.)

Timeline for d1r24b2: