Lineage for d1r24b2 (1r24 B:123-217)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365512Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (6 PDB entries)
  8. 365518Domain d1r24b2: 1r24 B:123-217 [21377]
    Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b1, d1r24c1, d1r24c2, d1r24d1

Details for d1r24b2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24b2 b.1.1.2 (B:123-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

SCOP Domain Coordinates for d1r24b2:

Click to download the PDB-style file with coordinates for d1r24b2.
(The format of our PDB-style files is described here.)

Timeline for d1r24b2: