Lineage for d1r24b2 (1r24 B:123-217)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221665Species Fab R24, (mouse), kappa L chain [49092] (2 PDB entries)
    from murine ascites
  8. 221669Domain d1r24b2: 1r24 B:123-217 [21377]
    Other proteins in same PDB: d1r24a1, d1r24b1, d1r24c1, d1r24d1

Details for d1r24b2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24b2 b.1.1.2 (B:123-217) Immunoglobulin (constant domains of L and H chains) {Fab R24, (mouse), kappa L chain}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik

SCOP Domain Coordinates for d1r24b2:

Click to download the PDB-style file with coordinates for d1r24b2.
(The format of our PDB-style files is described here.)

Timeline for d1r24b2: