| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab R24, (mouse), kappa L chain [49092] (2 PDB entries) from murine ascites |
| Domain d1r24b2: 1r24 B:123-217 [21377] Other proteins in same PDB: d1r24a1, d1r24b1, d1r24c1, d1r24d1 |
PDB Entry: 1r24 (more details), 3.1 Å
SCOP Domain Sequences for d1r24b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r24b2 b.1.1.2 (B:123-217) Immunoglobulin (constant domains of L and H chains) {Fab R24, (mouse), kappa L chain}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktdlik
Timeline for d1r24b2: