SCOPe 2.05: Domain d1r24a2: 1r24 A:108-206

Lineage for d1r24a2 (1r24 A:108-206)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1r24a2: 1r24 A:108-206 [21376]
Other proteins in same PDB: d1r24a1, d1r24b1, d1r24b2, d1r24c1, d1r24d1, d1r24d2
part of Fab R24 from murine ascites

Details for d1r24a2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

PDB Compounds: (A:) protein (igg3-kappa antibody (light chain))

SCOPe Domain Sequences for d1r24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24a2 b.1.1.2 (A:108-206) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspiv

SCOPe Domain Coordinates for d1r24a2:

Click to download the PDB-style file with coordinates for d1r24a2.
(The format of our PDB-style files is described here.)

Timeline for d1r24a2: