Lineage for d1r24a2 (1r24 A:108-206)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104364Species Fab R24, (mouse), kappa L chain [49092] (2 PDB entries)
  8. 104367Domain d1r24a2: 1r24 A:108-206 [21376]
    Other proteins in same PDB: d1r24a1, d1r24b1, d1r24c1, d1r24d1

Details for d1r24a2

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24a2 b.1.1.2 (A:108-206) Immunoglobulin (constant domains of L and H chains) {Fab R24, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspiv

SCOP Domain Coordinates for d1r24a2:

Click to download the PDB-style file with coordinates for d1r24a2.
(The format of our PDB-style files is described here.)

Timeline for d1r24a2: