Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries) Uniprot P04191 |
Domain d3n5kb2: 3n5k B:125-239 [213753] Other proteins in same PDB: d3n5ka1, d3n5ka3, d3n5ka4, d3n5kb1, d3n5kb3, d3n5kb4 automated match to d1wpga1 complexed with act, alf, k, mg, tg1 |
PDB Entry: 3n5k (more details), 2.2 Å
SCOPe Domain Sequences for d3n5kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n5kb2 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d3n5kb2:
View in 3D Domains from other chains: (mouse over for more information) d3n5ka1, d3n5ka2, d3n5ka3, d3n5ka4 |