Lineage for d3n5kb1 (3n5k B:1-124,B:240-343,B:751-994)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458250Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 1458251Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 1458252Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 1458253Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 1458254Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (37 PDB entries)
    Uniprot P04191
  8. 1458256Domain d3n5kb1: 3n5k B:1-124,B:240-343,B:751-994 [213752]
    Other proteins in same PDB: d3n5ka2, d3n5ka3, d3n5ka4, d3n5kb2, d3n5kb3, d3n5kb4
    automated match to d1wpga4
    complexed with act, alf, k, mg, tg1

Details for d3n5kb1

PDB Entry: 3n5k (more details), 2.2 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3n5kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n5kb1 f.33.1.1 (B:1-124,B:240-343,B:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d3n5kb1:

Click to download the PDB-style file with coordinates for d3n5kb1.
(The format of our PDB-style files is described here.)

Timeline for d3n5kb1: