Lineage for d1bz7b2 (1bz7 B:123-217)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159987Species Fab R24, (mouse), kappa L chain [49092] (2 PDB entries)
  8. 159989Domain d1bz7b2: 1bz7 B:123-217 [21375]
    Other proteins in same PDB: d1bz7a1, d1bz7b1

Details for d1bz7b2

PDB Entry: 1bz7 (more details), 2.5 Å

PDB Description: fab fragment from murine ascites

SCOP Domain Sequences for d1bz7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz7b2 b.1.1.2 (B:123-217) Immunoglobulin (constant domains of L and H chains) {Fab R24, (mouse), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqsg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdk

SCOP Domain Coordinates for d1bz7b2:

Click to download the PDB-style file with coordinates for d1bz7b2.
(The format of our PDB-style files is described here.)

Timeline for d1bz7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz7b1