| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (17 species) |
| Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries) Uniprot P32889 |
| Domain d3n5cb_: 3n5c B: [213746] automated match to d1re0a_ complexed with cl, gdp |
PDB Entry: 3n5c (more details), 1.82 Å
SCOPe Domain Sequences for d3n5cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n5cb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
eiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
Timeline for d3n5cb_: