Lineage for d3n5cb_ (3n5c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866686Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
    Uniprot P32889
  8. 2866693Domain d3n5cb_: 3n5c B: [213746]
    automated match to d1re0a_
    complexed with cl, gdp

Details for d3n5cb_

PDB Entry: 3n5c (more details), 1.82 Å

PDB Description: Crystal Structure of Arf6DELTA13 complexed with GDP
PDB Compounds: (B:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d3n5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n5cb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
eiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

SCOPe Domain Coordinates for d3n5cb_:

Click to download the PDB-style file with coordinates for d3n5cb_.
(The format of our PDB-style files is described here.)

Timeline for d3n5cb_: