Lineage for d3n5aa_ (3n5a A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773128Species Mouse (Mus musculus) [TaxId:10090] [187441] (4 PDB entries)
  8. 2773129Domain d3n5aa_: 3n5a A: [213744]
    automated match to d2yoaa_
    complexed with ca

Details for d3n5aa_

PDB Entry: 3n5a (more details), 1.44 Å

PDB Description: Synaptotagmin-7, C2B-domain, calcium bound
PDB Compounds: (A:) Synaptotagmin-7

SCOPe Domain Sequences for d3n5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n5aa_ b.7.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekkktvtk
krnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpgevkhwk
dmiarprqpvaqwhqlka

SCOPe Domain Coordinates for d3n5aa_:

Click to download the PDB-style file with coordinates for d3n5aa_.
(The format of our PDB-style files is described here.)

Timeline for d3n5aa_: