SCOPe 2.08: Domain d1bz7a2: 1bz7 A:108-206

Lineage for d1bz7a2 (1bz7 A:108-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1bz7a2: 1bz7 A:108-206 [21374]
   Other proteins in same PDB: d1bz7a1, d1bz7b1, d1bz7b2
   part of humanized Fab R24 from murine ascites

Details for d1bz7a2

PDB Entry: 1bz7, 2.5 Å

PDB Description: fab fragment from murine ascites

PDB Compounds: (A:) protein (antibody r24 (light chain))

SCOPe Domain Sequences for d1bz7a2:

Sequence; same for both SEQRES and ATOM records:

>d1bz7a2 b.1.1.2 (A:108-206) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvt

Timeline for d1bz7a2:

• d1bz7a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bz7a2 appears in SCOPe 2.07