Lineage for d3n59m_ (3n59 M:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839589Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 1839703Protein automated matches [190071] (5 species)
    not a true protein
  7. 1839736Species Mycobacterium tuberculosis [TaxId:1773] [189947] (15 PDB entries)
  8. 1839824Domain d3n59m_: 3n59 M: [213732]
    automated match to d3n8nd_
    complexed with 3ds, cl

Details for d3n59m_

PDB Entry: 3n59 (more details), 2.52 Å

PDB Description: Type II dehydroquinase from Mycobacterium Tuberculosis complexed with 3-dehydroshikimate
PDB Compounds: (M:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n59m_:

Sequence, based on SEQRES records: (download)

>d3n59m_ c.23.13.1 (M:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nlyfqshmselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqs
dseaqlldwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefr
rhsylspiatgvivglgiqgyllalrylaehv

Sequence, based on observed residues (ATOM records): (download)

>d3n59m_ c.23.13.1 (M:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nlyfqshmselivnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaql
ldwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsyls
piatgvivglgiqgyllalrylaehv

SCOPe Domain Coordinates for d3n59m_:

Click to download the PDB-style file with coordinates for d3n59m_.
(The format of our PDB-style files is described here.)

Timeline for d3n59m_: