Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab directed agains the musk odorant traseolide, (mouse), kappa L chain [49091] (1 PDB entry) |
Domain d1c12b2: 1c12 B:414-513 [21373] Other proteins in same PDB: d1c12a1, d1c12b1 |
PDB Entry: 1c12 (more details), 2.6 Å
SCOP Domain Sequences for d1c12b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c12b2 b.1.1.2 (B:414-513) Immunoglobulin (constant domains of L and H chains) {Fab directed agains the musk odorant traseolide, (mouse), kappa L chain} astkgpsvyplapgskaaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpe
Timeline for d1c12b2: