SCOP 1.57: Domain d1c12b2: 1c12 B:414-513

Lineage for d1c12b2 (1c12 B:414-513)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab directed agains the musk odorant traseolide, (mouse), kappa L chain [49091] (1 PDB entry)

8. Domain d1c12b2: 1c12 B:414-513 [21373]
   Other proteins in same PDB: d1c12a1, d1c12b1

Details for d1c12b2

PDB Entry: 1c12, 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

SCOP Domain Sequences for d1c12b2:

Sequence; same for both SEQRES and ATOM records:

>d1c12b2 b.1.1.2 (B:414-513) Immunoglobulin (constant domains of L and H chains) {Fab directed agains the musk odorant traseolide, (mouse), kappa L chain}
astkgpsvyplapgskaaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpe

Timeline for d1c12b2:

• d1c12b2 first appeared (with stable ids) in SCOP 1.55
  
• d1c12b2 appears in SCOP 1.59
  
• d1c12b2 appears in the current release, SCOPe 2.08