Lineage for d3n59h_ (3n59 H:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357747Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1357748Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 1357869Protein automated matches [190071] (4 species)
    not a true protein
  7. 1357888Species Mycobacterium tuberculosis [TaxId:1773] [189947] (7 PDB entries)
  8. 1357969Domain d3n59h_: 3n59 H: [213727]
    automated match to d3n8nd_
    complexed with 3ds, cl

Details for d3n59h_

PDB Entry: 3n59 (more details), 2.52 Å

PDB Description: Type II dehydroquinase from Mycobacterium Tuberculosis complexed with 3-dehydroshikimate
PDB Compounds: (H:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n59h_:

Sequence, based on SEQRES records: (download)

>d3n59h_ c.23.13.1 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

Sequence, based on observed residues (ATOM records): (download)

>d3n59h_ c.23.13.1 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
giqgyllalrylaeh

SCOPe Domain Coordinates for d3n59h_:

Click to download the PDB-style file with coordinates for d3n59h_.
(The format of our PDB-style files is described here.)

Timeline for d3n59h_: