Lineage for d1c12a2 (1c12 A:108-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365941Domain d1c12a2: 1c12 A:108-214 [21372]
    Other proteins in same PDB: d1c12a1, d1c12b1, d1c12b2
    part of antibody directed against the musk odorant traseolide
    complexed with trz

Details for d1c12a2

PDB Entry: 1c12 (more details), 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

SCOP Domain Sequences for d1c12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c12a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnea

SCOP Domain Coordinates for d1c12a2:

Click to download the PDB-style file with coordinates for d1c12a2.
(The format of our PDB-style files is described here.)

Timeline for d1c12a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c12a1