Lineage for d3n44f2 (3n44 F:293-391)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376051Species Chikungunya virus [TaxId:37124] [226027] (5 PDB entries)
  8. 2376053Domain d3n44f2: 3n44 F:293-391 [213719]
    Other proteins in same PDB: d3n44f1
    automated match to d2alaa1
    complexed with act, nag, os

Details for d3n44f2

PDB Entry: 3n44 (more details), 2.35 Å

PDB Description: crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n44f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n44f2 b.1.18.0 (F:293-391) automated matches {Chikungunya virus [TaxId: 37124]}
apsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsql
qisfstalasaefrvqvcstqvhcaaechppkdhivnyp

SCOPe Domain Coordinates for d3n44f2:

Click to download the PDB-style file with coordinates for d3n44f2.
(The format of our PDB-style files is described here.)

Timeline for d3n44f2: