| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Chikungunya virus [TaxId:37124] [226027] (5 PDB entries) |
| Domain d3n44f2: 3n44 F:293-391 [213719] Other proteins in same PDB: d3n44f1 automated match to d2alaa1 complexed with act, nag, os |
PDB Entry: 3n44 (more details), 2.35 Å
SCOPe Domain Sequences for d3n44f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n44f2 b.1.18.0 (F:293-391) automated matches {Chikungunya virus [TaxId: 37124]}
apsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsql
qisfstalasaefrvqvcstqvhcaaechppkdhivnyp
Timeline for d3n44f2: