SCOPe 2.07: Domain d3n44f1: 3n44 F:1-292

Lineage for d3n44f1 (3n44 F:1-292)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Chikungunya virus [TaxId:37124] [226026] (2 PDB entries)

8. Domain d3n44f1: 3n44 F:1-292 [213718]
   Other proteins in same PDB: d3n44f2
   automated match to d2alaa2
   complexed with act, nag, os

Details for d3n44f1

PDB Entry: 3n44, 2.35 Å

PDB Description: crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.

PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n44f1:

Sequence; same for both SEQRES and ATOM records:

>d3n44f1 f.10.1.0 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]}
yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

Timeline for d3n44f1:

• d3n44f1 first appeared in SCOPe 2.03
  
• d3n44f1 appears in SCOPe 2.06
  
• d3n44f1 appears in the current release, SCOPe 2.08