Lineage for d3n44f1 (3n44 F:1-292)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455723Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1455724Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 1455763Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 1455764Protein automated matches [227047] (3 species)
    not a true protein
  7. 1455765Species Chikungunya virus [TaxId:37124] [226026] (2 PDB entries)
  8. 1455766Domain d3n44f1: 3n44 F:1-292 [213718]
    Other proteins in same PDB: d3n44f2
    automated match to d2alaa2
    complexed with act, nag, os

Details for d3n44f1

PDB Entry: 3n44 (more details), 2.35 Å

PDB Description: crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; osmium soak) of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n44f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n44f1 f.10.1.0 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]}
yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

SCOPe Domain Coordinates for d3n44f1:

Click to download the PDB-style file with coordinates for d3n44f1.
(The format of our PDB-style files is described here.)

Timeline for d3n44f1: