Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (3 species) not a true protein |
Species Chikungunya virus [TaxId:37124] [226026] (2 PDB entries) |
Domain d3n44f1: 3n44 F:1-292 [213718] Other proteins in same PDB: d3n44f2 automated match to d2alaa2 complexed with act, nag, os |
PDB Entry: 3n44 (more details), 2.35 Å
SCOPe Domain Sequences for d3n44f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n44f1 f.10.1.0 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]} yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd
Timeline for d3n44f1: