Lineage for d3n43f1 (3n43 F:1-292)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628492Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2628493Protein automated matches [227047] (11 species)
    not a true protein
  7. 2628494Species Chikungunya virus [TaxId:37124] [226026] (2 PDB entries)
  8. 2628496Domain d3n43f1: 3n43 F:1-292 [213716]
    Other proteins in same PDB: d3n43f2, d3n43f3
    automated match to d2alaa2
    complexed with act, nag

Details for d3n43f1

PDB Entry: 3n43 (more details), 2.58 Å

PDB Description: crystal structures of the mature envelope glycoprotein complex (trypsin cleavage) of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n43f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n43f1 f.10.1.0 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]}
yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

SCOPe Domain Coordinates for d3n43f1:

Click to download the PDB-style file with coordinates for d3n43f1.
(The format of our PDB-style files is described here.)

Timeline for d3n43f1: