| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
| Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
| Protein automated matches [227047] (6 species) not a true protein |
| Species Chikungunya virus [TaxId:37124] [226026] (2 PDB entries) |
| Domain d3n43f1: 3n43 F:1-292 [213716] Other proteins in same PDB: d3n43f2, d3n43f3 automated match to d2alaa2 complexed with act, nag |
PDB Entry: 3n43 (more details), 2.58 Å
SCOPe Domain Sequences for d3n43f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n43f1 f.10.1.0 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]}
yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd
Timeline for d3n43f1: